Lineage for d3mc4b_ (3mc4 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423278Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423279Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2423626Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2423627Protein automated matches [190967] (35 species)
    not a true protein
  7. 2423678Species Brucella melitensis [TaxId:359391] [225881] (1 PDB entry)
  8. 2423680Domain d3mc4b_: 3mc4 B: [213194]
    automated match to d3gvda_
    complexed with cl, edo

Details for d3mc4b_

PDB Entry: 3mc4 (more details), 1.95 Å

PDB Description: crystal structure of ww/rsp5/wwp domain: bacterial transferase hexapeptide repeat: serine o-acetyltransferase from brucella melitensis
PDB Compounds: (B:) WW/Rsp5/WWP domain:Bacterial transferase hexapeptide repeat:Serine O-acetyltransferase

SCOPe Domain Sequences for d3mc4b_:

Sequence, based on SEQRES records: (download)

>d3mc4b_ b.81.1.0 (B:) automated matches {Brucella melitensis [TaxId: 359391]}
dpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrqt
fdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgrk
dfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggtg
kssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariige
tg

Sequence, based on observed residues (ATOM records): (download)

>d3mc4b_ b.81.1.0 (B:) automated matches {Brucella melitensis [TaxId: 359391]}
dpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrqt
fdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgrk
dfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggtg
drhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariigetg

SCOPe Domain Coordinates for d3mc4b_:

Click to download the PDB-style file with coordinates for d3mc4b_.
(The format of our PDB-style files is described here.)

Timeline for d3mc4b_: