SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3mc4b_ (3mc4 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069791Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2069792Protein automated matches [190967] (29 species)
    not a true protein
  7. 2069840Species Brucella melitensis [TaxId:359391] [225881] (1 PDB entry)
  8. 2069842Domain d3mc4b_: 3mc4 B: [213194]
    automated match to d3gvda_
    complexed with cl, edo

Details for d3mc4b_

PDB Entry: 3mc4 (more details), 1.95 Å

PDB Description: Crystal structure of WW/RSP5/WWP domain: bacterial transferase hexapeptide repeat: serine O-Acetyltransferase from Brucella Melitensis
PDB Compounds: (B:) WW/Rsp5/WWP domain:Bacterial transferase hexapeptide repeat:Serine O-acetyltransferase

SCOPe Domain Sequences for d3mc4b_:

Sequence, based on SEQRES records: (download)

>d3mc4b_ b.81.1.0 (B:) automated matches {Brucella melitensis [TaxId: 359391]}
dpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrqt
fdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgrk
dfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggtg
kssgdrhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariige
tg

Sequence, based on observed residues (ATOM records): (download)

>d3mc4b_ b.81.1.0 (B:) automated matches {Brucella melitensis [TaxId: 359391]}
dpiwhsiraeaeeatrndpvlgaflyatilnqpsleeavmhriaerlghpdvsadilrqt
fdtmleanpewshvlrvdiqavydrdpaysrfmdpvlylkgfhaiqthrlahwlykqgrk
dfayylqsrsssifqtdihpaarlgsglfldhatglvvgetavvednvsilhgvtlggtg
drhpkirqgvligagakilgniqvgqcskiaagsvvlksvphnvtvagvpariigetg

SCOPe Domain Coordinates for d3mc4b_:

Click to download the PDB-style file with coordinates for d3mc4b_.
(The format of our PDB-style files is described here.)

Timeline for d3mc4b_: