SCOPe 2.07: Domain d3lo8a2: 3lo8 A:157-316

Lineage for d3lo8a2 (3lo8 A:157-316)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [226538] (17 PDB entries)

8. Domain d3lo8a2: 3lo8 A:157-316 [212980]
   Other proteins in same PDB: d3lo8a1
   automated match to d1frna2
   complexed with fad, na

Details for d3lo8a2

PDB Entry: 3lo8, 1.05 Å

PDB Description: crystal structure of the oxidized form of ferredoxin:nadp+ reductase from maize root at 1.05 angstroms

PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d3lo8a2:

Sequence, based on SEQRES records:

>d3lo8a2 c.25.1.0 (A:157-316) automated matches {Maize (Zea mays) [TaxId: 4577]}
mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd
eeftsylkqypdnfrydkalsreqknrsggkmyvqdkieeysdeifklldggahiyfcgl
kgmmpgiqdtlkkvaerrgeswdqklaqlkknkqwhvevy

Sequence, based on observed residues (ATOM records):

>d3lo8a2 c.25.1.0 (A:157-316) automated matches {Maize (Zea mays) [TaxId: 4577]}
mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd
eeftsylkqypdnfrydkalsreqmyvqdkieeysdeifklldggahiyfcglkgmmpgi
qdtlkkvaerrgeswdqklaqlkknkqwhvevy

Timeline for d3lo8a2:

• d3lo8a2 first appeared in SCOPe 2.03
  
• d3lo8a2 appears in SCOPe 2.06
  
• d3lo8a2 appears in the current release, SCOPe 2.08