Lineage for d3lo8a2 (3lo8 A:157-316)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105127Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2105128Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2105290Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2105291Protein automated matches [226871] (18 species)
    not a true protein
  7. 2105324Species Maize (Zea mays) [TaxId:4577] [226538] (17 PDB entries)
  8. 2105325Domain d3lo8a2: 3lo8 A:157-316 [212980]
    Other proteins in same PDB: d3lo8a1
    automated match to d1frna2
    complexed with fad, na

Details for d3lo8a2

PDB Entry: 3lo8 (more details), 1.05 Å

PDB Description: Crystal Structure of The Oxidized Form of Ferredoxin:NADP+ Reductase From Maize Root at 1.05 Angstroms
PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d3lo8a2:

Sequence, based on SEQRES records: (download)

>d3lo8a2 c.25.1.0 (A:157-316) automated matches {Maize (Zea mays) [TaxId: 4577]}
mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd
eeftsylkqypdnfrydkalsreqknrsggkmyvqdkieeysdeifklldggahiyfcgl
kgmmpgiqdtlkkvaerrgeswdqklaqlkknkqwhvevy

Sequence, based on observed residues (ATOM records): (download)

>d3lo8a2 c.25.1.0 (A:157-316) automated matches {Maize (Zea mays) [TaxId: 4577]}
mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd
eeftsylkqypdnfrydkalsreqmyvqdkieeysdeifklldggahiyfcglkgmmpgi
qdtlkkvaerrgeswdqklaqlkknkqwhvevy

SCOPe Domain Coordinates for d3lo8a2:

Click to download the PDB-style file with coordinates for d3lo8a2.
(The format of our PDB-style files is described here.)

Timeline for d3lo8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lo8a1