Lineage for d3lnfa1 (3lnf A:3-101)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037192Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2037193Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2037201Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 2037224Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. 2037244Domain d3lnfa1: 3lnf A:3-101 [212960]
    automated match to d1ncja1
    complexed with ca

Details for d3lnfa1

PDB Entry: 3lnf (more details), 2.5 Å

PDB Description: crystal structure of e-cadherin ec12 k14ew2a
PDB Compounds: (A:) Cadherin-1

SCOPe Domain Sequences for d3lnfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lnfa1 b.1.6.1 (A:3-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
vippiscpeneegefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlkv
tqpldreaiakyilyshavssngeavedpmeivitvtdq

SCOPe Domain Coordinates for d3lnfa1:

Click to download the PDB-style file with coordinates for d3lnfa1.
(The format of our PDB-style files is described here.)

Timeline for d3lnfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lnfa2