| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.1: Cadherin [49314] (4 proteins) |
| Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
| Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries) |
| Domain d3lnfa1: 3lnf A:3-101 [212960] automated match to d1ncja1 complexed with ca |
PDB Entry: 3lnf (more details), 2.5 Å
SCOPe Domain Sequences for d3lnfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lnfa1 b.1.6.1 (A:3-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
vippiscpeneegefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlkv
tqpldreaiakyilyshavssngeavedpmeivitvtdq
Timeline for d3lnfa1: