SCOPe 2.04: Domain d3l6qa1: 3l6q A:18-204

Lineage for d3l6qa1 (3l6q A:18-204)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [225813] (1 PDB entry)

8. Domain d3l6qa1: 3l6q A:18-204 [212741]
   automated match to d2qw9a1
   complexed with mg, so4

Details for d3l6qa1

PDB Entry: 3l6q, 2.29 Å

PDB Description: crystal structure of the n-terminal domain of hsp70 from cryptosporidium parvum (cgd2_20)

PDB Compounds: (A:) Heat shock 70 (HSP70) protein

SCOPe Domain Sequences for d3l6qa1:

Sequence; same for both SEQRES and ATOM records:

>d3l6qa1 c.55.1.0 (A:18-204) automated matches {Cryptosporidium parvum [TaxId: 353152]}
ggpaigidlgttyscvgvwrndtvdivpndqgnrttpsyvafteterligdaaknqvarn
pentvfdakrligrkfddqavqsdmthwpfkvvrgpkdkpiisvnylgekkefhaeeisa
mvlqkmkeiseaylgrqiknavvtvpayfndsqrqatkdagaiaglnvmriineptaaai
aygldkk

Timeline for d3l6qa1:

• d3l6qa1 first appeared in SCOPe 2.03
  
• d3l6qa1 appears in SCOPe 2.05
  
• d3l6qa1 appears in the current release, SCOPe 2.08