Lineage for d3l6qa1 (3l6q A:18-204)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858597Species Cryptosporidium parvum [TaxId:353152] [225813] (1 PDB entry)
  8. 1858598Domain d3l6qa1: 3l6q A:18-204 [212741]
    automated match to d2qw9a1
    complexed with mg, so4

Details for d3l6qa1

PDB Entry: 3l6q (more details), 2.29 Å

PDB Description: crystal structure of the n-terminal domain of hsp70 from cryptosporidium parvum (cgd2_20)
PDB Compounds: (A:) Heat shock 70 (HSP70) protein

SCOPe Domain Sequences for d3l6qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l6qa1 c.55.1.0 (A:18-204) automated matches {Cryptosporidium parvum [TaxId: 353152]}
ggpaigidlgttyscvgvwrndtvdivpndqgnrttpsyvafteterligdaaknqvarn
pentvfdakrligrkfddqavqsdmthwpfkvvrgpkdkpiisvnylgekkefhaeeisa
mvlqkmkeiseaylgrqiknavvtvpayfndsqrqatkdagaiaglnvmriineptaaai
aygldkk

SCOPe Domain Coordinates for d3l6qa1:

Click to download the PDB-style file with coordinates for d3l6qa1.
(The format of our PDB-style files is described here.)

Timeline for d3l6qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3l6qa2