SCOPe 2.08: Domain d3l4fd1: 3l4f D:653-758

Lineage for d3l4fd1 (3l4f D:653-758)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Shank1, PDZ domain [101733] (2 species)
   SH3 and multiple ankyrin repeat domains protein 1

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101734] (5 PDB entries)

8. Domain d3l4fd1: 3l4f D:653-758 [212739]
   Other proteins in same PDB: d3l4fd2
   automated match to d1q3pb_

Details for d3l4fd1

PDB Entry: 3l4f, 2.8 Å

PDB Description: crystal structure of betapix coiled-coil domain and shank pdz complex

PDB Compounds: (D:) SH3 and multiple ankyrin repeat domains protein 1

SCOPe Domain Sequences for d3l4fd1:

Sequence; same for both SEQRES and ATOM records:

>d3l4fd1 b.36.1.1 (D:653-758) Shank1, PDZ domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggvaw
raglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtr

Timeline for d3l4fd1:

• d3l4fd1 first appeared in SCOPe 2.03, called d3l4fd_
  
• d3l4fd1 appears in SCOPe 2.07