PDB entry 3l4f

View 3l4f on RCSB PDB site
Description: Crystal Structure of betaPIX Coiled-Coil Domain and Shank PDZ Complex
Class: signaling protein/protein binding
Keywords: COILED-COIL, PDZ, Guanine-nucleotide releasing factor, Phosphoprotein, SH3 domain, ANK repeat, Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse, SIGNALING PROTEIN-PROTEIN BINDING complex
Deposited on 2009-12-19, released 2010-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Rho guanine nucleotide exchange factor 7
  Species: Rattus norvegicus [TaxId:10116]
  Gene: beta1PIX
  Database cross-references and differences (RAF-indexed):
  • Uniprot O55043 (1-60)
    • expression tag (0)
• Chain 'B':
  Compound: Rho guanine nucleotide exchange factor 7
  Species: Rattus norvegicus [TaxId:10116]
  Gene: beta1PIX
  Database cross-references and differences (RAF-indexed):
  • Uniprot O55043 (1-60)
    • expression tag (0)
• Chain 'C':
  Compound: Rho guanine nucleotide exchange factor 7
  Species: Rattus norvegicus [TaxId:10116]
  Gene: beta1PIX
  Database cross-references and differences (RAF-indexed):
  • Uniprot O55043 (1-End)
    • expression tag (0)
• Chain 'D':
  Compound: SH3 and multiple ankyrin repeat domains protein 1
  Species: Rattus norvegicus [TaxId:10116]
  Gene: shank1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WV48 (19-End)
    • expression tag (18)
  Domains in SCOPe 2.08: d3l4fd1, d3l4fd2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >3l4fD (D:)
  mgsshhhhhhsqdplvprgsgsdyiikektvllqkkdsegfgfvlrgakaqtpieeftpt
  pafpalqylesvdeggvawraglrmgdflievngqnvvkvghrqvvnmirqggntlmvkv
  vmvtrhpdmdea
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3l4fD (D:)
  gsgsdyiikektvllqkkdsegfgfvlrgakaqtpieeftptpafpalqylesvdeggva
  wraglrmgdflievngqnvvkvghrqvvnmirqggntlmvkvvmvtr