SCOPe 2.03: Domain d3l0ib_: 3l0i B:

Lineage for d3l0ib_ (3l0i B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries)

8. Domain d3l0ib_: 3l0i B: [212636]
   automated match to d3dz8a_
   complexed with cl, so4

Details for d3l0ib_

PDB Entry: 3l0i, 2.85 Å

PDB Description: complex structure of sidm/drra with the wild type rab1

PDB Compounds: (B:) Ras-related protein Rab-1A

SCOPe Domain Sequences for d3l0ib_:

Sequence, based on SEQRES records:

>d3l0ib_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smnpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktikl
qiwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllv
gnkcdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm

Sequence, based on observed residues (ATOM records):

>d3l0ib_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklq
iwdtagqerfrtitssrgahgiivvyvtdqesfnnvkqwlqeidryaenvnkllvnkcdl
tkvvdyttkefadslgipfletsatnveqsfmtmaaeikkrm

Timeline for d3l0ib_:

• d3l0ib_ is new in SCOPe 2.03-stable
  
• d3l0ib_ appears in SCOPe 2.04
  
• d3l0ib_ appears in the current release, SCOPe 2.08