Lineage for d3l0id_ (3l0i D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363774Protein automated matches [190047] (16 species)
    not a true protein
  7. 1363812Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries)
  8. 1364012Domain d3l0id_: 3l0i D: [212637]
    automated match to d3dz8a_
    complexed with cl, so4

Details for d3l0id_

PDB Entry: 3l0i (more details), 2.85 Å

PDB Description: complex structure of sidm/drra with the wild type rab1
PDB Compounds: (D:) Ras-related protein Rab-1A

SCOPe Domain Sequences for d3l0id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l0id_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smnpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktikl
qiwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllv
gnkcdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm

SCOPe Domain Coordinates for d3l0id_:

Click to download the PDB-style file with coordinates for d3l0id_.
(The format of our PDB-style files is described here.)

Timeline for d3l0id_: