Lineage for d3l0ga2 (3l0g A:108-274)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575461Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 1575533Family c.1.17.0: automated matches [227169] (1 protein)
    not a true family
  6. 1575534Protein automated matches [226879] (6 species)
    not a true protein
  7. 1575535Species Ehrlichia chaffeensis [TaxId:205920] [225806] (1 PDB entry)
  8. 1575536Domain d3l0ga2: 3l0g A:108-274 [212625]
    Other proteins in same PDB: d3l0ga1, d3l0gb1, d3l0gc1, d3l0gd1
    automated match to d1qapa1
    complexed with edo, fmt

Details for d3l0ga2

PDB Entry: 3l0g (more details), 2.05 Å

PDB Description: Crystal structure of Nicotinate-nucleotide pyrophosphorylase from Ehrlichia chaffeensis at 2.05A resolution
PDB Compounds: (A:) Nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d3l0ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l0ga2 c.1.17.0 (A:108-274) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
iasitrqfvdevsgtkvkirstrkttpglrmldkysvcigggesyrdnlcdgvlikdnhi
ascgsitlaiqrlrknlkneyiaiecdnisqveeslsnnvdmilldnmsiseikkavdiv
ngksvlevsgcvnirnvrnialtgvdyisigcitnsfqnkdigldie

SCOPe Domain Coordinates for d3l0ga2:

Click to download the PDB-style file with coordinates for d3l0ga2.
(The format of our PDB-style files is described here.)

Timeline for d3l0ga2: