SCOPe 2.06: Domain d3l0ga1: 3l0g A:3-107

Lineage for d3l0ga1 (3l0g A:3-107)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families)

5. Family d.41.2.0: automated matches [227168] (1 protein)
   not a true family

6. Protein automated matches [226878] (8 species)
   not a true protein

7. Species Ehrlichia chaffeensis [TaxId:205920] [225805] (1 PDB entry)

8. Domain d3l0ga1: 3l0g A:3-107 [212624]
   Other proteins in same PDB: d3l0ga2, d3l0gb2, d3l0gc2, d3l0gd2
   automated match to d1qapa2
   complexed with edo, fmt

Details for d3l0ga1

PDB Entry: 3l0g, 2.05 Å

PDB Description: Crystal structure of Nicotinate-nucleotide pyrophosphorylase from Ehrlichia chaffeensis at 2.05A resolution

PDB Compounds: (A:) Nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d3l0ga1:

Sequence; same for both SEQRES and ATOM records:

>d3l0ga1 d.41.2.0 (A:3-107) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
isfseiihnalkedlgdkgdittnsilinekvnfaintrenlvvcgipileevfnmnkeh
vkyeihkkdgditgknstlvsgealaiyllpiervilnfiqhasg

Timeline for d3l0ga1:

• d3l0ga1 first appeared in SCOPe 2.03
  
• d3l0ga1 appears in SCOPe 2.05
  
• d3l0ga1 appears in SCOPe 2.07
  
• d3l0ga1 appears in the current release, SCOPe 2.08