Lineage for d3l0gc1 (3l0g C:1-107)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2189055Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families) (S)
  5. 2189127Family d.41.2.0: automated matches [227168] (1 protein)
    not a true family
  6. 2189128Protein automated matches [226878] (8 species)
    not a true protein
  7. 2189129Species Ehrlichia chaffeensis [TaxId:205920] [225805] (1 PDB entry)
  8. 2189132Domain d3l0gc1: 3l0g C:1-107 [212628]
    Other proteins in same PDB: d3l0ga2, d3l0gb2, d3l0gc2, d3l0gd2
    automated match to d1qapa2
    complexed with edo, fmt

Details for d3l0gc1

PDB Entry: 3l0g (more details), 2.05 Å

PDB Description: Crystal structure of Nicotinate-nucleotide pyrophosphorylase from Ehrlichia chaffeensis at 2.05A resolution
PDB Compounds: (C:) Nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d3l0gc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l0gc1 d.41.2.0 (C:1-107) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
mkisfseiihnalkedlgdkgdittnsilinekvnfaintrenlvvcgipileevfnmnk
ehvkyeihkkdgditgknstlvsgealaiyllpiervilnfiqhasg

SCOPe Domain Coordinates for d3l0gc1:

Click to download the PDB-style file with coordinates for d3l0gc1.
(The format of our PDB-style files is described here.)

Timeline for d3l0gc1: