SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3kzua1 (3kzu A:1-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2147118Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2147119Protein automated matches [196909] (58 species)
    not a true protein
  7. 2147165Species Brucella melitensis [TaxId:29459] [225803] (1 PDB entry)
  8. 2147166Domain d3kzua1: 3kzu A:1-259 [212606]
    automated match to d1j3na1
    complexed with edo, so4

Details for d3kzua1

PDB Entry: 3kzu (more details), 1.75 Å

PDB Description: Crystal structure of 3-oxoacyl-(acyl carrier protein) synthase II from Brucella melitensis
PDB Compounds: (A:) 3-oxoacyl-(acyl-carrier-protein) synthase II

SCOPe Domain Sequences for d3kzua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kzua1 c.95.1.0 (A:1-259) automated matches {Brucella melitensis [TaxId: 29459]}
mrrvvitglglvsplasgveetwkrllagesgarrvtefevddlacqiacripvgdgtng
tfnpdlhmdpkeqrkvdpfivyavgaadqalddagwhpendedqvrtgvligsgiggieg
iveagytlrdkgprrispffipgrlinlasghvsikhklrgpnhsvvtacatgthaigda
arliafgdadvmvaggtespvsrislagfaackalsternddptaasrpydedrdgfvmg
egagivvleelehalarga

SCOPe Domain Coordinates for d3kzua1:

Click to download the PDB-style file with coordinates for d3kzua1.
(The format of our PDB-style files is described here.)

Timeline for d3kzua1: