![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Brucella melitensis [TaxId:29459] [225803] (1 PDB entry) |
![]() | Domain d3kzuc1: 3kzu C:1-259 [212610] automated match to d1j3na1 complexed with edo, so4 |
PDB Entry: 3kzu (more details), 1.75 Å
SCOPe Domain Sequences for d3kzuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kzuc1 c.95.1.0 (C:1-259) automated matches {Brucella melitensis [TaxId: 29459]} mrrvvitglglvsplasgveetwkrllagesgarrvtefevddlacqiacripvgdgtng tfnpdlhmdpkeqrkvdpfivyavgaadqalddagwhpendedqvrtgvligsgiggieg iveagytlrdkgprrispffipgrlinlasghvsikhklrgpnhsvvtacatgthaigda arliafgdadvmvaggtespvsrislagfaackalsternddptaasrpydedrdgfvmg egagivvleelehalarga
Timeline for d3kzuc1:
![]() Domains from other chains: (mouse over for more information) d3kzua1, d3kzua2, d3kzub1, d3kzub2 |