Lineage for d3kzub2 (3kzu B:260-420)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917468Species Brucella melitensis [TaxId:29459] [225803] (1 PDB entry)
  8. 2917472Domain d3kzub2: 3kzu B:260-420 [212609]
    automated match to d1j3na2
    complexed with edo, so4

Details for d3kzub2

PDB Entry: 3kzu (more details), 1.75 Å

PDB Description: Crystal structure of 3-oxoacyl-(acyl carrier protein) synthase II from Brucella melitensis
PDB Compounds: (B:) 3-oxoacyl-(acyl-carrier-protein) synthase II

SCOPe Domain Sequences for d3kzub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kzub2 c.95.1.0 (B:260-420) automated matches {Brucella melitensis [TaxId: 29459]}
kiyaevigygmsgdafhitaptesgegaqrcmvaalkragivpdeidyinahgtstmadt
ielgavervvgeaaakismsstkssighllgaagaaeavfstlairdniapatlnldnpa
aqtridlvphkprerkidvalsnsfgfggtnaslvlrryta

SCOPe Domain Coordinates for d3kzub2:

Click to download the PDB-style file with coordinates for d3kzub2.
(The format of our PDB-style files is described here.)

Timeline for d3kzub2: