Lineage for d3knda_ (3knd A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006377Protein Importin alpha [48376] (1 species)
  7. 2006378Species Mouse (Mus musculus) [TaxId:10090] [48377] (30 PDB entries)
  8. 2006382Domain d3knda_: 3knd A: [212432]
    automated match to d1pjmb_
    complexed with so4

Details for d3knda_

PDB Entry: 3knd (more details), 2.15 Å

PDB Description: tpx2:importin-alpha complex
PDB Compounds: (A:) Importin subunit alpha-2

SCOPe Domain Sequences for d3knda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3knda_ a.118.1.1 (A:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}
nqgtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflg
ktdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgni
agdgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldav
eqilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpi
vtpalraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdq
iqqvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnll
sakdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykasl
nliekyfs

SCOPe Domain Coordinates for d3knda_:

Click to download the PDB-style file with coordinates for d3knda_.
(The format of our PDB-style files is described here.)

Timeline for d3knda_: