SCOPe 2.06: Domain d3kmob2: 3kmo B:79-209

Lineage for d3kmob2 (3kmo B:79-209)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (63 PDB entries)

8. Domain d3kmob2: 3kmo B:79-209 [212430]
   Other proteins in same PDB: d3kmoa1, d3kmob1
   automated match to d1gssa1
   complexed with ca, eaa, gsh; mutant

Details for d3kmob2

PDB Entry: 3kmo, 2.6 Å

PDB Description: crystal structure of the human gst pi c47s/y108v double mutant in complex with the ethacrynic acid-glutathione conjugate (grown in the absence of the reducing agent dtt)

PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d3kmob2:

Sequence; same for both SEQRES and ATOM records:

>d3kmob2 a.45.1.1 (B:79-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ygkdqqeaalvdmvndgvedlrckyislivtnyeagkddyvkalpgqlkpfetllsqnqg
gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey
vnlpingngkq

Timeline for d3kmob2:

• d3kmob2 first appeared in SCOPe 2.03
  
• d3kmob2 appears in SCOPe 2.05
  
• d3kmob2 appears in SCOPe 2.07
  
• d3kmob2 appears in the current release, SCOPe 2.08