Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class pi GST [81347] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [47619] (63 PDB entries) |
Domain d1gssa1: 1gss A:77-207 [17584] Other proteins in same PDB: d1gssa2, d1gssb2 complexed with lee |
PDB Entry: 1gss (more details), 2.8 Å
SCOPe Domain Sequences for d1gssa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gssa1 a.45.1.1 (A:77-207) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} ygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqnqg gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey vnlpingngkq
Timeline for d1gssa1: