SCOPe 2.03: Domain d3kkya1: 3kky A:1-87

Lineage for d3kkya1 (3kky A:1-87)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein automated matches [227044] (1 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:1299] [226010] (1 PDB entry)

8. Domain d3kkya1: 3kky A:1-87 [212407]
   Other proteins in same PDB: d3kkya2, d3kkyb2
   automated match to d1y67a1
   complexed with mn

Details for d3kkya1

PDB Entry: 3kky, 1.8 Å

PDB Description: Structure of Manganese Superoxide Dismutase from Deinococcus Radiodurans in the orthorhombic space group P212121: A case study of mistaken identity

PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d3kkya1:

Sequence; same for both SEQRES and ATOM records:

>d3kkya1 a.2.11.1 (A:1-87) automated matches {Deinococcus radiodurans [TaxId: 1299]}
aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld
rvpadkkgalrnnagghanhsmfwqim

Timeline for d3kkya1:

• d3kkya1 is new in SCOPe 2.03-stable
  
• d3kkya1 appears in SCOPe 2.04
  
• d3kkya1 appears in the current release, SCOPe 2.08