Lineage for d3kkya2 (3kky A:99-210)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411453Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1411454Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1411455Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 1411715Protein automated matches [226880] (2 species)
    not a true protein
  7. 1411716Species Deinococcus radiodurans [TaxId:1299] [226011] (1 PDB entry)
  8. 1411717Domain d3kkya2: 3kky A:99-210 [212408]
    Other proteins in same PDB: d3kkya1, d3kkyb1
    automated match to d1y67a2
    complexed with mn

Details for d3kkya2

PDB Entry: 3kky (more details), 1.8 Å

PDB Description: Structure of Manganese Superoxide Dismutase from Deinococcus Radiodurans in the orthorhombic space group P212121: A case study of mistaken identity
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d3kkya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kkya2 d.44.1.1 (A:99-210) automated matches {Deinococcus radiodurans [TaxId: 1299]}
psgelldainsafgsfdafkqkfedaaktrfgsgwawlvvkdgkldvvstanqdnplmge
aiagvsgtpilgvdvwehayylnyqnrrpdylaafwnvvnwdevskryaaak

SCOPe Domain Coordinates for d3kkya2:

Click to download the PDB-style file with coordinates for d3kkya2.
(The format of our PDB-style files is described here.)

Timeline for d3kkya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kkya1