![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
![]() | Protein automated matches [227044] (1 species) not a true protein |
![]() | Species Deinococcus radiodurans [TaxId:1299] [226010] (1 PDB entry) |
![]() | Domain d3kkyb1: 3kky B:1-87 [212409] Other proteins in same PDB: d3kkya2, d3kkyb2 automated match to d1y67a1 complexed with mn |
PDB Entry: 3kky (more details), 1.8 Å
SCOPe Domain Sequences for d3kkyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kkyb1 a.2.11.1 (B:1-87) automated matches {Deinococcus radiodurans [TaxId: 1299]} aytlpqlpyaydalephidartmeihhtkhhqtyvdnankalegtefadlpveqliqqld rvpadkkgalrnnagghanhsmfwqim
Timeline for d3kkyb1: