![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Putative acetyltransferase PA4794 [143700] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [143701] (22 PDB entries) Uniprot Q9HV14 1-160 |
![]() | Domain d3kkwa1: 3kkw A:1-159 [212406] Other proteins in same PDB: d3kkwa2 automated match to d3pgpa_ complexed with edo, so4 |
PDB Entry: 3kkw (more details), 1.41 Å
SCOPe Domain Sequences for d3kkwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kkwa1 d.108.1.1 (A:1-159) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgq vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfna naaglllytqlgyqpraiaerhdpdgrrvaliqmdkple
Timeline for d3kkwa1: