Lineage for d3kk0a_ (3kk0 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1608160Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1609191Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 1609205Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 1609206Protein automated matches [193326] (6 species)
    not a true protein
  7. 1609221Species Mycobacterium smegmatis [TaxId:246196] [225939] (4 PDB entries)
  8. 1609224Domain d3kk0a_: 3kk0 A: [212395]
    automated match to d4jy7a_
    complexed with bme, edo, ipa, peg

Details for d3kk0a_

PDB Entry: 3kk0 (more details), 2.65 Å

PDB Description: Crystal structure of partially folded intermediate state of peptidyl-tRNA hydrolase from Mycobacterium smegmatis
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d3kk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kk0a_ c.56.3.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
maepllvvglgnpgptyaktrhnlgfmvadvlagrigsafkvhkksgaevvtgrlagttv
vlakprismnesgrqvgplakfysvppqqivvihdeldidfgrirlklgggegghnglrs
vasalgtknfhrvrigvgrppgrkdpaafvlenftsaeraevptiveqaadatelliaqg
lepaqntvhaw

SCOPe Domain Coordinates for d3kk0a_:

Click to download the PDB-style file with coordinates for d3kk0a_.
(The format of our PDB-style files is described here.)

Timeline for d3kk0a_: