SCOPe 2.03: Domain d3kk0a_: 3kk0 A:

Lineage for d3kk0a_ (3kk0 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (5 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [225939] (3 PDB entries)

8. Domain d3kk0a_: 3kk0 A: [212395]
   automated match to d4jy7a_
   complexed with bme, edo, ipa, peg

Details for d3kk0a_

PDB Entry: 3kk0, 2.65 Å

PDB Description: Crystal structure of partially folded intermediate state of peptidyl-tRNA hydrolase from Mycobacterium smegmatis

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d3kk0a_:

Sequence; same for both SEQRES and ATOM records:

>d3kk0a_ c.56.3.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
maepllvvglgnpgptyaktrhnlgfmvadvlagrigsafkvhkksgaevvtgrlagttv
vlakprismnesgrqvgplakfysvppqqivvihdeldidfgrirlklgggegghnglrs
vasalgtknfhrvrigvgrppgrkdpaafvlenftsaeraevptiveqaadatelliaqg
lepaqntvhaw

Timeline for d3kk0a_:

• d3kk0a_ is new in SCOPe 2.03-stable
  
• d3kk0a_ appears in SCOPe 2.04
  
• d3kk0a_ appears in the current release, SCOPe 2.08