Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (18 species) not a true protein |
Species Bacillus anthracis [TaxId:261594] [189450] (4 PDB entries) |
Domain d3kb8a_: 3kb8 A: [212268] automated match to d1r3ub_ complexed with 5gp, gol, mg, po4, suc |
PDB Entry: 3kb8 (more details), 2.09 Å
SCOPe Domain Sequences for d3kb8a_:
Sequence, based on SEQRES records: (download)
>d3kb8a_ c.61.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]} mhhhhhhssgvdlgtenlyfqsnammnqdiekvliseeqiqekvlelgaiiaedykntvp laigvlkgampfmadllkrtdtylemdfmavssyghstvstgevkilkdldtsvegrdil ivediidsgltlsylvdlfkyrkaksvkivtlldkptgrkvdlkadyvgftvphefvvgy gldykeqyrnlpyvgvlkpsvys
>d3kb8a_ c.61.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]} mhhhhhhssgvgtenlyfqsnammnqdiekvliseeqiqekvlelgaiiaedykntvpla igvlkgampfmadllkrtdtylemdfmavssyghstvstgevkilkdldtsvegrdiliv ediidsgltlsylvdlfkyrkaksvkivtlldkptgrkvdlkadyvgftvphefvvgygl dykeqyrnlpyvgvlkpsvys
Timeline for d3kb8a_: