SCOPe 2.08: Domain d3kb8a1: 3kb8 A:-10-179

Lineage for d3kb8a1 (3kb8 A:-10-179)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [189450] (7 PDB entries)

8. Domain d3kb8a1: 3kb8 A:-10-179 [212268]
   Other proteins in same PDB: d3kb8a2, d3kb8b2, d3kb8c2, d3kb8d2
   automated match to d1r3ub_
   complexed with 5gp, gol, mg, po4

Details for d3kb8a1

PDB Entry: 3kb8, 2.09 Å

PDB Description: 2.09 angstrom resolution structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-1) from bacillus anthracis str. 'ames ancestor' in complex with gmp

PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3kb8a1:

Sequence; same for both SEQRES and ATOM records:

>d3kb8a1 c.61.1.0 (A:-10-179) automated matches {Bacillus anthracis [TaxId: 261594]}
gtenlyfqsnammnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfm
adllkrtdtylemdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltls
ylvdlfkyrkaksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpy
vgvlkpsvys

Timeline for d3kb8a1:

• d3kb8a1 first appeared in SCOPe 2.03, called d3kb8a_
  
• d3kb8a1 appears in SCOPe 2.07