SCOPe 2.06: Domain d3k5ma2: 3k5m A:390-770

Lineage for d3k5ma2 (3k5m A:390-770)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)

6. Protein automated matches [226972] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225831] (3 PDB entries)

8. Domain d3k5ma2: 3k5m A:390-770 [212169]
   Other proteins in same PDB: d3k5ma1, d3k5ma3
   automated match to d1q8ia2
   protein/DNA complex; complexed with ca, dg3

Details for d3k5ma2

PDB Entry: 3k5m, 2.04 Å

PDB Description: crystal structure of e.coli pol ii-abasic dna-ddgtp lt(-2, 2) ternary complex

PDB Compounds: (A:) DNA polymerase II

SCOPe Domain Sequences for d3k5ma2:

Sequence; same for both SEQRES and ATOM records:

>d3k5ma2 e.8.1.1 (A:390-770) automated matches {Escherichia coli [TaxId: 562]}
nlgevpphaspggyvmdsrpglydsvlvldykslypsiirtflidpvglvegmaqpdpeh
stegfldawfsrekhclpeivtniwhgrdeakrqgnkplsqalkiimnafygvlgttacr
ffdprlassitmrghqimrqtkalieaqgydviygdtdstfvwlkgahseeeaakigral
vqhvnawwaetlqkqrltsaleleyethfcrflmptirgadtgskkryagliqegdkqrm
vfkgletvrtdwtplaqqfqqelylrifrnepyqeyvretidklmageldarlvyrkrlr
rplseyqrnvpphvraarladeenqkrgrplqyqnrgtikyvwttngpepldyqrspldy
ehyltrqlqpvaegilpfied

Timeline for d3k5ma2:

• d3k5ma2 first appeared in SCOPe 2.03
  
• d3k5ma2 appears in SCOPe 2.05
  
• d3k5ma2 appears in SCOPe 2.07
  
• d3k5ma2 appears in the current release, SCOPe 2.08