Lineage for d3js4b2 (3js4 B:90-206)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946332Species Anaplasma phagocytophilum [TaxId:212042] [225758] (1 PDB entry)
  8. 2946334Domain d3js4b2: 3js4 B:90-206 [212067]
    Other proteins in same PDB: d3js4a1, d3js4a3, d3js4b1, d3js4b3, d3js4c1, d3js4d1
    automated match to d1unfx2
    complexed with fe, na

Details for d3js4b2

PDB Entry: 3js4 (more details), 1.95 Å

PDB Description: crystal structure of iron superoxide dismutase from anaplasma phagocytophilum
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d3js4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3js4b2 d.44.1.0 (B:90-206) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
ngggnppeklremiehsfgsvegfnnafttsglgqfgsgwvwlvydedakalkvvstana
dsplltqgqlplatmdvwehayyldylnlrkkyidvflehllnwdfvlgrledagvl

SCOPe Domain Coordinates for d3js4b2:

Click to download the PDB-style file with coordinates for d3js4b2.
(The format of our PDB-style files is described here.)

Timeline for d3js4b2: