Lineage for d3js4d1 (3js4 D:1-89)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690372Species Anaplasma phagocytophilum [TaxId:212042] [225757] (1 PDB entry)
  8. 2690376Domain d3js4d1: 3js4 D:1-89 [212070]
    Other proteins in same PDB: d3js4a2, d3js4a3, d3js4b2, d3js4b3, d3js4c2, d3js4d2
    automated match to d1unfx1
    complexed with fe, na

Details for d3js4d1

PDB Entry: 3js4 (more details), 1.95 Å

PDB Description: crystal structure of iron superoxide dismutase from anaplasma phagocytophilum
PDB Compounds: (D:) superoxide dismutase

SCOPe Domain Sequences for d3js4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3js4d1 a.2.11.0 (D:1-89) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
mfelsdlpyeglepyisshlldrhynghhktyvdvlnklvvgtefeglgneslgdivvka
hnsgsagraifnnaaqiwnhdfywqsmkp

SCOPe Domain Coordinates for d3js4d1:

Click to download the PDB-style file with coordinates for d3js4d1.
(The format of our PDB-style files is described here.)

Timeline for d3js4d1: