![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (39 species) not a true protein |
![]() | Species Anaplasma phagocytophilum [TaxId:212042] [225757] (1 PDB entry) |
![]() | Domain d3js4b1: 3js4 B:1-89 [212066] Other proteins in same PDB: d3js4a2, d3js4a3, d3js4b2, d3js4b3, d3js4c2, d3js4d2 automated match to d1unfx1 complexed with fe, na |
PDB Entry: 3js4 (more details), 1.95 Å
SCOPe Domain Sequences for d3js4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3js4b1 a.2.11.0 (B:1-89) automated matches {Anaplasma phagocytophilum [TaxId: 212042]} mfelsdlpyeglepyisshlldrhynghhktyvdvlnklvvgtefeglgneslgdivvka hnsgsagraifnnaaqiwnhdfywqsmkp
Timeline for d3js4b1: