SCOPe 2.08: Domain d1nfdh2: 1nfd H:115-228

Lineage for d1nfdh2 (1nfd H:115-228)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [88579] (1 PDB entry)

8. Domain d1nfdh2: 1nfd H:115-228 [21205]
   Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde1, d1nfde2, d1nfdf1, d1nfdg1, d1nfdg2, d1nfdh1
   part of Fab H57
   complexed with nag

Details for d1nfdh2

PDB Entry: 1nfd, 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

PDB Compounds: (H:) h57 fab

SCOPe Domain Sequences for d1nfdh2:

Sequence; same for both SEQRES and ATOM records:

>d1nfdh2 b.1.1.2 (H:115-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
tttapsvyplapacdsttsttdtvtlgclvkgyfpepvtvswnsgaltsgvhtfpsvlhs
glyslsssvtvpsstwpkqpitcnvahpasstkvdkkiepr

Timeline for d1nfdh2:

• d1nfdh2 first appeared (with stable ids) in SCOP 1.55
  
• d1nfdh2 appears in SCOPe 2.07