SCOPe 2.08: Domain d1nfdh1: 1nfd H:1-114

Lineage for d1nfdh1 (1nfd H:1-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [88561] (1 PDB entry)

8. Domain d1nfdh1: 1nfd H:1-114 [20189]
   Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde1, d1nfde2, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh2
   part of Fab H57
   complexed with nag

Details for d1nfdh1

PDB Entry: 1nfd, 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

PDB Compounds: (H:) h57 fab

SCOPe Domain Sequences for d1nfdh1:

Sequence; same for both SEQRES and ATOM records:

>d1nfdh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
evylvesggdlvqpgsslkvscaasgftfsdfwmywvrqapgkglewvgriknipnnyat
eyadsvrgrftisrddsrnsiylqmnrlrvddtaiyyctragrfdhfdywgqgtmvtvss
a

Timeline for d1nfdh1:

• d1nfdh1 first appeared (with stable ids) in SCOP 1.55
  
• d1nfdh1 appears in SCOPe 2.07