SCOPe 2.08: Domain d1nfda1: 1nfd A:1-117

Lineage for d1nfda1 (1nfd A:1-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries)

8. Domain d1nfda1: 1nfd A:1-117 [20612]
   Other proteins in same PDB: d1nfda2, d1nfdb2, d1nfdc2, d1nfdd2, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2
   complexed with nag

Details for d1nfda1

PDB Entry: 1nfd, 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

PDB Compounds: (A:) n15 alpha-beta T-cell receptor

SCOPe Domain Sequences for d1nfda1:

Sequence; same for both SEQRES and ATOM records:

>d1nfda1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
dsvtqteglvtvteglpvklnctyqttyltiaffwyvqylneapqvllksstdnkrtehq
gfhatlhkssssfhlqkssaqlsdsalyycalseggnykyvfgagtrlkviah

Timeline for d1nfda1:

• d1nfda1 first appeared (with stable ids) in SCOP 1.55
  
• d1nfda1 appears in SCOPe 2.07