Lineage for d3iweb1 (3iwe B:116-295)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209749Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2209750Protein automated matches [190038] (42 species)
    not a true protein
  7. 2209825Species Human (Homo sapiens) [TaxId:9606] [225745] (21 PDB entries)
  8. 2209836Domain d3iweb1: 3iwe B:116-295 [211975]
    automated match to d1iyka1
    complexed with 646, mya

Details for d3iweb1

PDB Entry: 3iwe (more details), 1.79 Å

PDB Description: Crystal Structure of human type-I N-myristoyltransferase with bound myristoyl-CoA and inhibitor DDD85646
PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d3iweb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iweb1 d.108.1.0 (B:116-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelytl
lnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanihi
ydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtcr

SCOPe Domain Coordinates for d3iweb1:

Click to download the PDB-style file with coordinates for d3iweb1.
(The format of our PDB-style files is described here.)

Timeline for d3iweb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3iweb2