SCOP 1.69: Domain d2hrpn2: 2hrp N:114-212

Lineage for d2hrpn2 (2hrp N:114-212)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d2hrpn2: 2hrp N:114-212 [21197]
   Other proteins in same PDB: d2hrph1, d2hrpl1, d2hrpl2, d2hrpm1, d2hrpm2, d2hrpn1
   part of Fab F11.2.32 against HIV-1 protease

Details for d2hrpn2

PDB Entry: 2hrp, 2.2 Å

PDB Description: antigen-antibody complex

SCOP Domain Sequences for d2hrpn2:

Sequence; same for both SEQRES and ATOM records:

>d2hrpn2 b.1.1.2 (N:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d2hrpn2:

• d2hrpn2 first appeared (with stable ids) in SCOP 1.55
  
• d2hrpn2 appears in SCOP 1.67
  
• d2hrpn2 appears in SCOP 1.71
  
• d2hrpn2 appears in the current release, SCOPe 2.08