PDB entry 2hrp

View 2hrp on RCSB PDB site
Description: antigen-antibody complex
Deposited on 1996-12-27, released 1997-12-31
The last revision prior to the SCOP 1.69 freeze date was dated 1997-12-31, with a file datestamp of 1997-12-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hrpH (H:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2hrpL (L:)
    dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hrpL (L:)
    dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hrpM (M:)
    dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2hrpN (N:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hrpN (N:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp