| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [189215] (23 PDB entries) |
| Domain d3iseo_: 3ise O: [211916] automated match to d3is7s_ complexed with fe, hem, k |
PDB Entry: 3ise (more details), 2.8 Å
SCOPe Domain Sequences for d3iseo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iseo_ a.25.1.1 (O:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklieri
lfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllkd
ileseeehidyletqlgliqkvglenylqshmhe
Timeline for d3iseo_: