SCOP 1.69: Domain d1hyxh2: 1hyx H:114-215

Lineage for d1hyxh2 (1hyx H:114-215)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d1hyxh2: 1hyx H:114-215 [21191]
   Other proteins in same PDB: d1hyxh1, d1hyxl1, d1hyxl2
   part of hydrolytic antibody 6D9

Details for d1hyxh2

PDB Entry: 1hyx, 1.8 Å

PDB Description: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyxh2:

Sequence; same for both SEQRES and ATOM records:

>d1hyxh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d1hyxh2:

• d1hyxh2 first appeared (with stable ids) in SCOP 1.55
  
• d1hyxh2 appears in SCOP 1.67
  
• d1hyxh2 appears in SCOP 1.71
  
• d1hyxh2 last appears in SCOP 1.73