SCOP 1.69: Domain d1hyxh1: 1hyx H:1-113

Lineage for d1hyxh1 (1hyx H:1-113)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (16 PDB entries)

8. Domain d1hyxh1: 1hyx H:1-113 [20167]
   Other proteins in same PDB: d1hyxh2, d1hyxl1, d1hyxl2
   part of hydrolytic antibody 6D9

Details for d1hyxh1

PDB Entry: 1hyx, 1.8 Å

PDB Description: high resolution crystal structure of the complex of the hydrolytic antibody fab 6d9 and a transition-state analog

SCOP Domain Sequences for d1hyxh1:

Sequence; same for both SEQRES and ATOM records:

>d1hyxh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1}
evkllesggglvkpggslklscaasgftfsnyamswvrqtpekrlewvvsissggsiyyl
dsvkgrftvsrdnarnilylqmtslrsedtamyfcarvshydgsrdwyfdvwgagtsvtv
ss

Timeline for d1hyxh1:

• d1hyxh1 first appeared (with stable ids) in SCOP 1.55
  
• d1hyxh1 appears in SCOP 1.67
  
• d1hyxh1 appears in SCOP 1.71
  
• d1hyxh1 last appears in SCOP 1.73