Lineage for d3is8l_ (3is8 L:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702789Species Pseudomonas aeruginosa [TaxId:287] [189215] (23 PDB entries)
  8. 2703077Domain d3is8l_: 3is8 L: [211886]
    automated match to d4e6kf_
    complexed with fe2, hem, k, so4

Details for d3is8l_

PDB Entry: 3is8 (more details), 2.25 Å

PDB Description: structure of mineralized bfrb soaked with feso4 from pseudomonas aeruginosa to 2.25a resolution
PDB Compounds: (L:) bacterioferritin

SCOPe Domain Sequences for d3is8l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3is8l_ a.25.1.1 (L:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
kgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklier
ilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdllk
dileseeehidyletqlgliqkvglenylqshmhe

SCOPe Domain Coordinates for d3is8l_:

Click to download the PDB-style file with coordinates for d3is8l_.
(The format of our PDB-style files is described here.)

Timeline for d3is8l_: