Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins) Pfam PF02295 |
Protein automated matches [190680] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225893] (3 PDB entries) |
Domain d3irra_: 3irr A: [211855] automated match to d1qbjc_ protein/DNA complex; protein/RNA complex; complexed with epe |
PDB Entry: 3irr (more details), 2.65 Å
SCOPe Domain Sequences for d3irra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3irra_ a.4.5.19 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gshmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplw kia
Timeline for d3irra_: