SCOPe 2.05: Domain d3irra_: 3irr A:

Lineage for d3irra_ (3irr A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
   Pfam PF02295

6. Protein automated matches [190680] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225893] (3 PDB entries)

8. Domain d3irra_: 3irr A: [211855]
   automated match to d1qbjc_
   protein/DNA complex; protein/RNA complex; complexed with epe

Details for d3irra_

PDB Entry: 3irr, 2.65 Å

PDB Description: Crystal Structure of a Z-Z junction (with HEPES intercalating)

PDB Compounds: (A:) Double-stranded RNA-specific adenosine deaminase

SCOPe Domain Sequences for d3irra_:

Sequence; same for both SEQRES and ATOM records:

>d3irra_ a.4.5.19 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplw
kia

Timeline for d3irra_:

• d3irra_ first appeared in SCOPe 2.03
  
• d3irra_ appears in SCOPe 2.04
  
• d3irra_ is called d3irra1 in SCOPe 2.06
  
• d3irra_ appears in the current release, SCOPe 2.08, called d3irra1