Lineage for d3iq1a_ (3iq1 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2318506Species Vibrio cholerae [TaxId:243277] [225741] (1 PDB entry)
  8. 2318507Domain d3iq1a_: 3iq1 A: [211841]
    Other proteins in same PDB: d3iq1b2, d3iq1c2, d3iq1d2
    automated match to d1dpsa_
    complexed with cl

Details for d3iq1a_

PDB Entry: 3iq1 (more details), 1.67 Å

PDB Description: Crystal structure of DPS protein from Vibrio cholerae O1, a member of a broad superfamily of ferritin-like diiron-carboxylate proteins
PDB Compounds: (A:) Dps family protein

SCOPe Domain Sequences for d3iq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iq1a_ a.25.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
matnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiytdl
qlkidelaeriltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhqqrd
ilelagetgdegtsalmsdyireqeklvwmlnawlk

SCOPe Domain Coordinates for d3iq1a_:

Click to download the PDB-style file with coordinates for d3iq1a_.
(The format of our PDB-style files is described here.)

Timeline for d3iq1a_: