Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [225741] (1 PDB entry) |
Domain d3iq1a_: 3iq1 A: [211841] Other proteins in same PDB: d3iq1b2, d3iq1c2, d3iq1d2 automated match to d1dpsa_ complexed with cl |
PDB Entry: 3iq1 (more details), 1.67 Å
SCOPe Domain Sequences for d3iq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iq1a_ a.25.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} matnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiytdl qlkidelaeriltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhqqrd ilelagetgdegtsalmsdyireqeklvwmlnawlk
Timeline for d3iq1a_: