Lineage for d3ikpc2 (3ikp C:235-355)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1940571Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1940958Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 1940959Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (9 PDB entries)
  8. 1940980Domain d3ikpc2: 3ikp C:235-355 [211796]
    Other proteins in same PDB: d3ikpa1, d3ikpb1, d3ikpc1
    automated match to d1pwba1
    complexed with ca, ipd

Details for d3ikpc2

PDB Entry: 3ikp (more details), 1.75 Å

PDB Description: crystal structure of inositol phosphate bound trimeric human lung surfactant protein d
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3ikpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ikpc2 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d3ikpc2:

Click to download the PDB-style file with coordinates for d3ikpc2.
(The format of our PDB-style files is described here.)

Timeline for d3ikpc2: