![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
![]() | Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
![]() | Protein Surfactant protein [57949] (2 species) |
![]() | Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries) |
![]() | Domain d3ikpb1: 3ikp B:204-234 [211793] Other proteins in same PDB: d3ikpa2, d3ikpb2, d3ikpc2 automated match to d1pwba2 complexed with ca, ipd |
PDB Entry: 3ikp (more details), 1.75 Å
SCOPe Domain Sequences for d3ikpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ikpb1 h.1.1.1 (B:204-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]} vaslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d3ikpb1:
![]() Domains from other chains: (mouse over for more information) d3ikpa1, d3ikpa2, d3ikpc1, d3ikpc2 |