Lineage for d3iknc1 (3ikn C:204-234)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039232Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 3039233Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 3039305Protein Surfactant protein [57949] (3 species)
  7. 3039306Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)
  8. 3039318Domain d3iknc1: 3ikn C:204-234 [211789]
    Other proteins in same PDB: d3ikna2, d3iknb2, d3iknc2
    automated match to d1pwba2
    complexed with ca, gal

Details for d3iknc1

PDB Entry: 3ikn (more details), 1.6 Å

PDB Description: crystal structure of galactose bound trimeric human lung surfactant protein d
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3iknc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iknc1 h.1.1.1 (C:204-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
vaslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d3iknc1:

Click to download the PDB-style file with coordinates for d3iknc1.
(The format of our PDB-style files is described here.)

Timeline for d3iknc1: