Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) |
Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
Protein Surfactant protein [57949] (3 species) |
Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries) |
Domain d3iknc1: 3ikn C:204-234 [211789] Other proteins in same PDB: d3ikna2, d3iknb2, d3iknc2 automated match to d1pwba2 complexed with ca, gal |
PDB Entry: 3ikn (more details), 1.6 Å
SCOPe Domain Sequences for d3iknc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iknc1 h.1.1.1 (C:204-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]} vaslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d3iknc1:
View in 3D Domains from other chains: (mouse over for more information) d3ikna1, d3ikna2, d3iknb1, d3iknb2 |